Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase, PDE1/PDE5
LigandBDBM279094
Substrate/Competitorn/a
Meas. Tech.PDE1 Inhibition Assay
pH7.6±n/a
Temperature298.15±n/a K
IC50 0.320±n/a nM
Commentsextracted
Citation Kehler, JJuhl, KMarigo, MVital, PJJessing, MLanggård, MRasmussen, LKClementson, CM 1H-pyrazolo[4,3-b]pyridines as PDE1 inhibitors US Patent US10034861 Publication Date 7/31/2018
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase, PDE1/PDE5
Name:Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Synonyms:63 kDa Cam-PDE | Calcium/calmodulin-dependent 3 ,5 -cyclic nucleotide phosphodiesterase 1B | Cam-PDE 1B | PDE1B | PDE1B1 | PDES1B | Phosphodiesterase 1B | Phosphodiesterase 1B (PDE1B1) | Phosphodiesterase Type 1 (PDE1B)
Type:Enzyme
Mol. Mass.:61366.51
Organism:Homo sapiens (Human)
Description:n/a
Residue:536
Sequence:
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM279094
NameBDBM279094
Synonyms:5-(2-ethoxy-3-pyridyl)-N-[(5-methoxy-3-pyridyl)methyl]-3-methyl-1-[1-methylpropyl]pyrazolo[4,3-b]pyridin-7-amine,enantiomer 2 | US10034861, Example 125
TypeSmall organic molecule
Emp. Form.C25H30N6O2
Mol. Mass.446.5447
SMILESCCOc1ncccc1-c1cc(NCc2cncc(OC)c2)c2n(nc(C)c2n1)C(C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a