Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAromatase (CYP19)
LigandBDBM19461
Substrate/Competitorn/a
Meas. Tech.Aromatase Assay
Ki 0.00109662±0.0 nM
IC50 1.0e+3± 0 nM
Citation Luqman, SMeena, ASingh, PKondratyuk, TPMarler, LEPezzuto, JMNegi, AS Neoflavonoids and Tetrahydroquinolones as Possible Cancer Chemopreventive Agents. Chem Biol Drug Des80:616-624 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aromatase (CYP19)
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Cytochrome P-450AROM | Cytochrome P450 19A1 | Cytochrome P450 2C19 | Cytochrome P450-C19 (CYP19) | Estrogen synthetase | FL cytokine receptor precursor | P-450AROM | Tyrosine Kinase FLT3
Type:Enzyme
Mol. Mass.:57888.92
Organism:Homo sapiens (human)
Description:P11511
Residue:503
Sequence:
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19461
NameBDBM19461
Synonyms:α-CA inhibitor, 5 | 5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one | CHEMBL32571 | Naringenin | Naringenin (NAR) | naringetol | salipurpol
TypeEstrgen Antagonist
Emp. Form.C15H12O5
Mol. Mass.272.2528
SMILESOc1ccc(cc1)C1CC(=O)c2c(O)cc(O)cc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a