BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLecithin-cholesterol acyltransferase (LCAT)
LigandBDBM92616
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7.5±0
Temperature277.15±0 K
IC50 60±0.0 nM
Citation Jauhiainen, MYuan, wGelb, MHDolphin, J Human Plasma Lecithin-Cholesterol Acyltransferase J Biol Chem264:1963-1967 (1989)  
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Lecithin-cholesterol acyltransferase (LCAT)
Name:Lecithin-cholesterol acyltransferase (LCAT)
Synonyms:Phosphatidylcholine-sterol acyltransferase | Phospholipid-cholesterol acyltransferase
Type:Protein
Mol. Mass.:49573.79
Organism:Homo sapiens (Human)
Description:P04180
Residue:440
Sequence:
MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQL
EAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGV
QIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEY
YRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGS
IKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGR
DFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDP
VGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLG
AYRQGPPASPTASPEPPPPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92616
NameBDBM92616
Synonyms:Difluoroketone phospholipid analogue, 4
Typen/a
Emp. Form.C25H48F2NO7P
Mol. Mass.543.6217
SMILESCCCCCCCC(=O)OCC(COP([O-])(=O)OCC[N+](C)(C)C)CC(=O)C(F)(F)CCCCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a