Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-protein thioesterase 2
LigandBDBM26137
Substrate/Competitorn/a
Meas. Tech.Enzymatic Protein Activity Assay
IC50>5.0e+4± 0 nM
Citation Zimmermann, TJBürger, MTashiro, EKondoh, YMartinez, NEGörmer, KRosin-Steiner, SShimizu, TOzaki, SMikoshiba, KWatanabe, NHall, DVetter, IROsada, HHedberg, CWaldmann, H Boron-based inhibitors of acyl protein thioesterases 1 and 2. Chembiochem14:115-22 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-protein thioesterase 2
Name:Acyl-protein thioesterase 2
Synonyms:Acyl-protein thioesterase 2 (APT2 WT) | Lysophospholipase II
Type:Protein
Mol. Mass.:24740.23
Organism:Homo sapiens (Human)
Description:O95372
Residue:231
Sequence:
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26137
NameBDBM26137
Synonyms:(2-phenylphenyl)boranediol | Phenylboronic Acid, 16 | Phenylboronic acid, 24
TypeSmall organic molecule
Emp. Form.C12H11BO2
Mol. Mass.198.026
SMILESOB(O)c1ccccc1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a