Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase H (USA-Cyp)
LigandBDBM92912
Substrate/Competitorn/a
Meas. Tech.PPIase Assay
Ki>1.00e+5± 0 nM
Citation Daum, SSchumann, MMathea, SAumüller, TBalsley, MAConstant, SLde Lacroix, BFKruska, FBraun, MSchiene-Fischer, C Isoform-specific inhibition of cyclophilins. Biochemistry48:6268-77 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase H (USA-Cyp)
Name:Peptidyl-prolyl cis-trans isomerase H (USA-Cyp)
Synonyms:Small nuclear ribonucleoprotein particle-specific cyclophilin H
Type:Protein
Mol. Mass.:19211.45
Organism:Homo sapiens (Human)
Description:O43447
Residue:177
Sequence:
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92912
NameBDBM92912
Synonyms:Aryl 1-indanylketone, 1
TypeSmall molecule
Emp. Form.C22H15FN2O7
Mol. Mass.438.3621
SMILESOc1c(cc(cc1N(=O)=O)-c1cc(F)cc(c1O)N(=O)=O)C(=O)C1CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a