Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucose-1-phosphate thymidylyltransferase (RmlA)
LigandBDBM93083
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 73± 1e+1 nM
Citation Alphey, MSPirrie, LTorrie, LSBoulkeroua, WAGardiner, MSarkar, AMaringer, MOehlmann, WBrenk, RScherman, MSMcNeil, MRejzek, MField, RASingh, MGray, DWestwood, NJNaismith, JH Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa. ACS Chem Biol8:387-96 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucose-1-phosphate thymidylyltransferase (RmlA)
Name:Glucose-1-phosphate thymidylyltransferase (RmlA)
Synonyms:n/a
Type:Protein
Mol. Mass.:32451.00
Organism:Pseudomonas aeruginosa
Description:Q9HU22
Residue:293
Sequence:
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDT
PRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHE
LLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQ
QVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA
TLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93083
NameBDBM93083
Synonyms:Analogue of 1a, 8a
TypeSmall molecule
Emp. Form.C18H18N4O4S
Mol. Mass.386.425
SMILESCN(c1c(N)n(Cc2ccccc2)c(=O)[nH]c1=O)S(=O)(=O)c1ccccc1
Structure
n/a