Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-dehydroquinate synthase
LigandBDBM93206
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition
Ki 1.2e+2± 0 nM
Citation Widlanski, TBender, SLKnowles, JR Dehydroquinate synthase: the use of substrate analogues to probe the late steps of the catalyzed reaction. Biochemistry28:7572-82 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-dehydroquinate synthase
Name:3-dehydroquinate synthase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:38878.02
Organism:Escherichia coli (strain K12)
Description:P07639
Residue:362
Sequence:
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS
GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA
GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ
SA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93206
NameBDBM93206
Synonyms:2,4,5-trihydroxy-6-(phosphonatomethyl)oxane-2-carboxylate, 4
TypeSmall molecule
Emp. Form.C7H10O9P
Mol. Mass.269.1243
SMILESOC1CC(O)(OC(CP([O-])([O-])=O)C1O)C([O-])=O
Structure
n/a