Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-B receptor 3 (EPHB3)
LigandBDBM93228
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50 1.58e+5± 0 nM
Citation Urich, RWishart, GKiczun, MRichters, ATidten-Luksch, NRauh, DSherborne, BWyatt, PGBrenk, R De novo design of protein kinase inhibitors by in silico identification of hinge region-binding fragments. ACS Chem Biol8:1044-52 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-B receptor 3 (EPHB3)
Name:Ephrin type-B receptor 3 (EPHB3)
Synonyms:Ephrin receptor | Ephrin type-B receptor 3
Type:Protein
Mol. Mass.:110326.17
Organism:Homo sapiens (Human)
Description:P54753
Residue:998
Sequence:
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93228
NameBDBM93228
Synonyms:Kinase inhibitor, D1
TypeSmall molecule
Emp. Form.C11H17N5
Mol. Mass.219.2862
SMILESCC(C)(C)Nc1c([nH]c2ncnn12)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a