BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSKiNhead family member (skn-1)
LigandBDBM93711
Substrate/Competitorn/a
IC50 1460±n/a nM
Citation PubChem, PC Dose ResponseConfirmation of SKN-1 Inhibitor hits in a fluorescence ratio assay - Set 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
SKiNhead family member (skn-1)
Name:SKiNhead family member (skn-1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:70701.17
Organism:Caenorhabditis elegans
Description:P34707
Residue:623
Sequence:
MGGSSRRQRSTSATRRDDKRRRRQCFSSVADDEEETTSIYGVSSIFIWILATSSLILVIS
SPSSNTSIQSSSYDRITTKHLLDNISPTFKMYTDSNNRNFDEVNHQHQQEQDFNGQSKYD
YPQFNRPMGLRWRDDQRMMEYFMSNGPVETVPVMPILTEHPPASPFGRGPSTERPTTSSR
YEYSSPSLEDIDLIDVLWRSDIAGEKGTRQVAPADQYECDLQTLTEKSTVAPLTAEENAR
YEDLSKGFYNGFFESFNNNQYQQKHQQQQREQIKTPTLEHPTQKAELEDDLFDEDLAQLF
EDVSREEGQLNQLFDNKQQHPVINNVSLSEGIVYNQANLTEMQEMRDSCNQVSISTIPTT
STAQPETLFNVTDSQTVEQWLPTEVVPNDVFPTSNYAYIGMQNDSLQAVVSNGQIDYDHS
YQSTGQTPLSPLIIGSSGRQQQTQTSPGSVTVTATATQSLFDPYHSQRHSFSDCTTDSSS
TCSRLSSESPRYTSESSTGTHESRFYGKLAPSSGSRYQRSSSPRSSQSSIKIARVVPLAS
GQRKRGRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKIRRRGK
NKVAARTCRQRRTDRHDKMSHYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93711
NameBDBM93711
Synonyms:2-(2,4-dichlorophenyl)-5-phenyl-1,3,4-oxadiazole | MLS000056596 | SMR000064579 | cid_96854
TypeSmall organic molecule
Emp. Form.C14H8Cl2N2O
Mol. Mass.291.132
SMILESClc1ccc(-c2nnc(o2)-c2ccccc2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a