BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSKiNhead family member (skn-1)
LigandBDBM93899
Substrate/Competitorn/a
IC50 12700±n/a nM
Citation PubChem, PC Dose ResponseConfirmation of SKN-1 Inhibitor hits in a fluorescence ratio assay - Set 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
SKiNhead family member (skn-1)
Name:SKiNhead family member (skn-1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:70701.17
Organism:Caenorhabditis elegans
Description:P34707
Residue:623
Sequence:
MGGSSRRQRSTSATRRDDKRRRRQCFSSVADDEEETTSIYGVSSIFIWILATSSLILVIS
SPSSNTSIQSSSYDRITTKHLLDNISPTFKMYTDSNNRNFDEVNHQHQQEQDFNGQSKYD
YPQFNRPMGLRWRDDQRMMEYFMSNGPVETVPVMPILTEHPPASPFGRGPSTERPTTSSR
YEYSSPSLEDIDLIDVLWRSDIAGEKGTRQVAPADQYECDLQTLTEKSTVAPLTAEENAR
YEDLSKGFYNGFFESFNNNQYQQKHQQQQREQIKTPTLEHPTQKAELEDDLFDEDLAQLF
EDVSREEGQLNQLFDNKQQHPVINNVSLSEGIVYNQANLTEMQEMRDSCNQVSISTIPTT
STAQPETLFNVTDSQTVEQWLPTEVVPNDVFPTSNYAYIGMQNDSLQAVVSNGQIDYDHS
YQSTGQTPLSPLIIGSSGRQQQTQTSPGSVTVTATATQSLFDPYHSQRHSFSDCTTDSSS
TCSRLSSESPRYTSESSTGTHESRFYGKLAPSSGSRYQRSSSPRSSQSSIKIARVVPLAS
GQRKRGRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKIRRRGK
NKVAARTCRQRRTDRHDKMSHYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93899
NameBDBM93899
Synonyms:MLS001172099 | N-(3-methylsulfanylphenyl)quinoline-8-carboxamide | N-[3-(methylthio)phenyl]-8-quinolinecarboxamide | N-[3-(methylthio)phenyl]quinoline-8-carboxamide | SMR000595098 | cid_9119958
TypeSmall organic molecule
Emp. Form.C17H14N2OS
Mol. Mass.294.371
SMILESCSc1cccc(NC(=O)c2cccc3cccnc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a