BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSKiNhead family member (skn-1)
LigandBDBM51918
Substrate/Competitorn/a
IC50 10900±n/a nM
Citation PubChem, PC Dose ResponseConfirmation of SKN-1 Inhibitor hits in a fluorescence ratio assay - Set 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
SKiNhead family member (skn-1)
Name:SKiNhead family member (skn-1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:70701.17
Organism:Caenorhabditis elegans
Description:P34707
Residue:623
Sequence:
MGGSSRRQRSTSATRRDDKRRRRQCFSSVADDEEETTSIYGVSSIFIWILATSSLILVIS
SPSSNTSIQSSSYDRITTKHLLDNISPTFKMYTDSNNRNFDEVNHQHQQEQDFNGQSKYD
YPQFNRPMGLRWRDDQRMMEYFMSNGPVETVPVMPILTEHPPASPFGRGPSTERPTTSSR
YEYSSPSLEDIDLIDVLWRSDIAGEKGTRQVAPADQYECDLQTLTEKSTVAPLTAEENAR
YEDLSKGFYNGFFESFNNNQYQQKHQQQQREQIKTPTLEHPTQKAELEDDLFDEDLAQLF
EDVSREEGQLNQLFDNKQQHPVINNVSLSEGIVYNQANLTEMQEMRDSCNQVSISTIPTT
STAQPETLFNVTDSQTVEQWLPTEVVPNDVFPTSNYAYIGMQNDSLQAVVSNGQIDYDHS
YQSTGQTPLSPLIIGSSGRQQQTQTSPGSVTVTATATQSLFDPYHSQRHSFSDCTTDSSS
TCSRLSSESPRYTSESSTGTHESRFYGKLAPSSGSRYQRSSSPRSSQSSIKIARVVPLAS
GQRKRGRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKIRRRGK
NKVAARTCRQRRTDRHDKMSHYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51918
NameBDBM51918
Synonyms:2-[[2-[2-(dimethylamino)ethylamino]-1-oxoethyl]amino]-4-(4-phenylphenyl)-3-thiophenecarboxylic acid ethyl ester;hydrochloride | 2-[[2-[2-(dimethylamino)ethylamino]acetyl]amino]-4-(4-phenylphenyl)thiophene-3-carboxylic acid ethyl ester;hydrochloride | MLS001166622 | SMR000587920 | cid_16241897 | ethyl 2-[2-[2-(dimethylamino)ethylamino]ethanoylamino]-4-(4-phenylphenyl)thiophene-3-carboxylate;hydrochloride | ethyl 2-[[2-[2-(dimethylamino)ethylamino]acetyl]amino]-4-(4-phenylphenyl)thiophene-3-carboxylate;hydrochloride
TypeSmall organic molecule
Emp. Form.C25H29N3O3S
Mol. Mass.451.581
SMILESCCOC(=O)c1c(NC(=O)CNCCN(C)C)scc1-c1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a