BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein Wnt-3a
LigandBDBM89234
Substrate/Competitorn/a
IC50 4510±n/a nM
Citation PubChem, PC Dose response validation of uHTS Gli-SUFU antagonist hits in a Wnt3a luminescent reporter assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
Protein Wnt-3a
Name:Protein Wnt-3a
Synonyms:protein Wnt-3a precursor
Type:PROTEIN
Mol. Mass.:39269.29
Organism:Mus musculus
Description:ChEMBL_813156
Residue:352
Sequence:
MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM89234
NameBDBM89234
Synonyms:7-butyl-1,3-dimethyl-8-[[methyl-(phenylmethyl)amino]methyl]purine-2,6-dione | 8-[[benzyl(methyl)amino]methyl]-7-butyl-1,3-dimethyl-xanthine | 8-[[benzyl(methyl)amino]methyl]-7-butyl-1,3-dimethylpurine-2,6-dione | MLS000039612 | SMR000035250 | cid_667213
TypeSmall organic molecule
Emp. Form.C20H27N5O2
Mol. Mass.369.4607
SMILESCCCCn1c(CN(C)Cc2ccccc2)nc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a