BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLARGE
LigandBDBM94645
Substrate/Competitorn/a
EC50 7050±n/a nM
Citation PubChem, PC SAR analysis of small molecule activators of alpha dystroglycan glycosylation PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
LARGE
Name:LARGE
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:88079.63
Organism:Homo sapiens
Description:gi_47678551
Residue:756
Sequence:
MLGICRGRRKFLAASLSLLCIPAITWIYLFSGSFEDGKPVSLSPLESQAHSPRYTASSQR
ERESLEVRMREVEEENRALRRQLSLAQGRAPSHRRGNHSKTYSMEEGTGDSENLRAGIVA
GNSSECGQQPVVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAEQ
ILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIV
LDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHRPWPALGRGYNTGVI
LLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQLPCFWNVQL
SDHTRSEQCYRDVSDLKVIHWNSPKKLRVKNKHVEFFRNLYLTFLEYDGNLLRRELFGCP
SEADVNSENLQKQLSELDEDDLCYEFRRERFTVHRTHLYFLHYEYEPAADSTDVTLVAQL
SMDRLQMLEAICKHWEGPISLALYLSDAEAQQFLRYAQGSEVLMSRHNVGYHIVYKEGQF
YPVNLLRNVAMKHISTPYMFLSDIDFLPMYGLYEYLRKSVIQLDLANTKKAMIVPAFETL
RYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATTPYRVEWEADFEPY
VVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSN
KQYRICLKTLKEEFQQDMSRRYGFAALKYLTAENNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM94645
NameBDBM94645
Synonyms:MLS-0356781.0001 | N-butan-2-yl-4-(1H-indol-3-yl)-1,3-thiazol-2-amine | N-butan-2-yl-4-(1H-indol-3-yl)-2-thiazolamine | [4-(1H-indol-3-yl)thiazol-2-yl]-sec-butyl-amine | cid_3491956
TypeSmall organic molecule
Emp. Form.C15H17N3S
Mol. Mass.271.381
SMILESCCC(C)Nc1nc(cs1)-c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a