BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLARGE
LigandBDBM94646
Substrate/Competitorn/a
EC50 34500±n/a nM
Citation PubChem, PC SAR analysis of small molecule activators of alpha dystroglycan glycosylation PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
LARGE
Name:LARGE
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:88079.63
Organism:Homo sapiens (Human)
Description:gi_47678551
Residue:756
Sequence:
MLGICRGRRKFLAASLSLLCIPAITWIYLFSGSFEDGKPVSLSPLESQAHSPRYTASSQR
ERESLEVRMREVEEENRALRRQLSLAQGRAPSHRRGNHSKTYSMEEGTGDSENLRAGIVA
GNSSECGQQPVVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAEQ
ILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIV
LDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHRPWPALGRGYNTGVI
LLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQLPCFWNVQL
SDHTRSEQCYRDVSDLKVIHWNSPKKLRVKNKHVEFFRNLYLTFLEYDGNLLRRELFGCP
SEADVNSENLQKQLSELDEDDLCYEFRRERFTVHRTHLYFLHYEYEPAADSTDVTLVAQL
SMDRLQMLEAICKHWEGPISLALYLSDAEAQQFLRYAQGSEVLMSRHNVGYHIVYKEGQF
YPVNLLRNVAMKHISTPYMFLSDIDFLPMYGLYEYLRKSVIQLDLANTKKAMIVPAFETL
RYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATTPYRVEWEADFEPY
VVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSN
KQYRICLKTLKEEFQQDMSRRYGFAALKYLTAENNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM94646
NameBDBM94646
Synonyms:1-(4-fluorophenyl)-2-(2-imino-3-methyl-1-benzimidazolyl)ethanone;hydrobromide | 1-(4-fluorophenyl)-2-(2-imino-3-methyl-benzimidazol-1-yl)ethanone;hydrobromide | 1-(4-fluorophenyl)-2-(2-imino-3-methylbenzimidazol-1-yl)ethanone;hydrobromide | 2-(2-azanylidene-3-methyl-benzimidazol-1-yl)-1-(4-fluorophenyl)ethanone;hydrobromide | MLS-0322108.0001 | cid_24761194
TypeSmall organic molecule
Emp. Form.C16H14FN3O
Mol. Mass.283.3003
SMILESCn1c2ccccc2n(CC(=O)c2ccc(F)cc2)c1=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a