BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM94887
Substrate/Competitorn/a
IC50 1820±n/a nM
Citation PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, via a fluorescence intensity assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM94887
NameBDBM94887
Synonyms:1,3-benzodioxole-5-carboxylic acid [4-[(E)-[[(5-bromo-3-pyridinyl)-oxomethyl]hydrazinylidene]methyl]phenyl] ester | 4-{2-[(5-bromo-3-pyridinyl)carbonyl]carbonohydrazonoyl}phenyl 1,3-benzodioxole-5-carboxylate | MLS000573024 | SMR000184953 | [4-[(E)-[(5-bromanylpyridin-3-yl)carbonylhydrazinylidene]methyl]phenyl] 1,3-benzodioxole-5-carboxylate | [4-[(E)-[(5-bromopyridine-3-carbonyl)hydrazinylidene]methyl]phenyl] 1,3-benzodioxole-5-carboxylate | cid_6898925 | piperonylic acid [4-[(E)-[(5-bromonicotinoyl)hydrazono]methyl]phenyl] ester
TypeSmall organic molecule
Emp. Form.C21H14BrN3O5
Mol. Mass.468.257
SMILESBrc1cncc(c1)C(=O)N\N=C\c1ccc(OC(=O)c2ccc3OCOc3c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a