BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50211918
Substrate/Competitorn/a
IC50 2910±n/a nM
Citation PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, via a fluorescence intensity assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211918
NameBDBM50211918
Synonyms:CHEMBL226187 | N-(5-chloro-2-hydroxyphenyl)-5-(4-methoxyphenyl)isoxazole-3-carboxamide | cid_17252838
TypeSmall organic molecule
Emp. Form.C17H13ClN2O4
Mol. Mass.344.749
SMILESCOc1ccc(cc1)-c1cc(no1)C(=O)Nc1cc(Cl)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a