Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1, mitochondrial
LigandBDBM279789
Substrate/Competitorn/a
Meas. Tech.G-402 cell line assay
EC50 0.892±n/a nM
Citation Aebi, JAmrein, KEChen, JHornsperger, BKuhn, BLiu, YLi, DMaerki, HPMartin, REMayweg, ATan, XWu, JYu, J Spirodiamine derivatives as aldosterone synthase inhibitors US Patent US10035804 Publication Date 7/31/2018
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1, mitochondrial
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM279789
NameBDBM279789
Synonyms:US10035804, Example 60
TypeSmall organic molecule
Emp. Form.C28H31ClN6O2
Mol. Mass.519.038
SMILESCCn1cc(cn1)C(=O)N1CC2(C1)CCN(CC2)c1cncc(c1)N1C(=O)c2ccc(Cl)cc2C1(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a