BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnuclear receptor subfamily 5 group A member 2 isoform 2
LigandBDBM95526
Substrate/Competitorn/a
IC50 5109±n/a nM
Citation PubChem, PC Luminescence-based cell-based high throughput dose response assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
nuclear receptor subfamily 5 group A member 2 isoform 2
Name:Liver Receptor Homolog 1
Synonyms:Alpha-1-fetoprotein transcription factor | B1-binding factor | CYP7A promoter-binding factor | Hepatocytic transcription factor | LRH-1 | Nuclear receptor subfamily 5 group A member 2 | hB1F
Type:Nuclear Hormone Receptor
Mol. Mass.:61341.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:541
Sequence:
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95526
NameBDBM95526
Synonyms:4-[2-[[2-[(2-methylphenyl)amino]-2-oxidanylidene-ethyl]-propyl-amino]ethanoylamino]benzamide | 4-[[2-[[2-(2-methylanilino)-2-oxoethyl]-propylamino]-1-oxoethyl]amino]benzamide | 4-[[2-[[2-(2-methylanilino)-2-oxoethyl]-propylamino]acetyl]amino]benzamide | 4-[[2-[[2-keto-2-(o-toluidino)ethyl]-propyl-amino]acetyl]amino]benzamide | MLS000878101 | SMR000376995 | cid_2522096
TypeSmall organic molecule
Emp. Form.C21H26N4O3
Mol. Mass.382.4561
SMILESCCCN(CC(=O)Nc1ccc(cc1)C(N)=O)CC(=O)Nc1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a