BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnuclear receptor subfamily 5 group A member 2 isoform 2
LigandBDBM95592
Substrate/Competitorn/a
IC50 167.85±n/a nM
Citation PubChem, PC Luminescence-based cell-based high throughput dose response assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
nuclear receptor subfamily 5 group A member 2 isoform 2
Name:Liver Receptor Homolog 1
Synonyms:Alpha-1-fetoprotein transcription factor | B1-binding factor | CYP7A promoter-binding factor | Hepatocytic transcription factor | LRH-1 | Nuclear receptor subfamily 5 group A member 2 | hB1F
Type:Nuclear Hormone Receptor
Mol. Mass.:61341.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:541
Sequence:
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95592
NameBDBM95592
Synonyms:2-(2-keto-4,7-dimethyl-chromen-5-yl)oxy-N-thiazol-2-yl-acetamide | 2-(4,7-dimethyl-2-oxidanylidene-chromen-5-yl)oxy-N-(1,3-thiazol-2-yl)ethanamide | 2-(4,7-dimethyl-2-oxochromen-5-yl)oxy-N-(1,3-thiazol-2-yl)acetamide | 2-[(4,7-dimethyl-2-oxo-1-benzopyran-5-yl)oxy]-N-(2-thiazolyl)acetamide | MLS001160235 | SMR000652760 | cid_8069390
TypeSmall organic molecule
Emp. Form.C16H14N2O4S
Mol. Mass.330.358
SMILESCc1cc(OCC(=O)Nc2nccs2)c2c(C)cc(=O)oc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a