BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnuclear receptor subfamily 5 group A member 2 isoform 2
LigandBDBM95611
Substrate/Competitorn/a
IC50>3985±n/a nM
Citation PubChem, PC Luminescence-based cell-based high throughput dose response assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
nuclear receptor subfamily 5 group A member 2 isoform 2
Name:Liver Receptor Homolog 1
Synonyms:Alpha-1-fetoprotein transcription factor | B1-binding factor | CYP7A promoter-binding factor | Hepatocytic transcription factor | LRH-1 | Nuclear receptor subfamily 5 group A member 2 | hB1F
Type:Nuclear Hormone Receptor
Mol. Mass.:61341.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:541
Sequence:
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95611
NameBDBM95611
Synonyms:2-[(5-keto-2H-1,2,4-triazin-3-yl)thio]-N-(3-nitrophenyl)acetamide | MLS001235922 | N-(3-nitrophenyl)-2-[(5-oxidanylidene-2H-1,2,4-triazin-3-yl)sulfanyl]ethanamide | N-(3-nitrophenyl)-2-[(5-oxo-2H-1,2,4-triazin-3-yl)sulfanyl]acetamide | N-(3-nitrophenyl)-2-[(5-oxo-2H-1,2,4-triazin-3-yl)thio]acetamide | SMR000807179 | cid_7151212
TypeSmall organic molecule
Emp. Form.C11H9N5O4S
Mol. Mass.307.285
SMILES[O-][N+](=O)c1cccc(NC(=O)CSc2[nH+]ncc(=O)[n-]2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a