BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnuclear receptor subfamily 5 group A member 2 isoform 2
LigandBDBM95632
Substrate/Competitorn/a
IC50 168.81±n/a nM
Citation PubChem, PC Luminescence-based cell-based high throughput dose response assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
nuclear receptor subfamily 5 group A member 2 isoform 2
Name:Liver Receptor Homolog 1
Synonyms:Alpha-1-fetoprotein transcription factor | B1-binding factor | CYP7A promoter-binding factor | Hepatocytic transcription factor | LRH-1 | Nuclear receptor subfamily 5 group A member 2 | hB1F
Type:Nuclear Hormone Receptor
Mol. Mass.:61341.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:541
Sequence:
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95632
NameBDBM95632
Synonyms:2-[1,3-bis(oxidanylidene)-3a,4,7,7a-tetrahydroisoindol-2-yl]-N-(4-bromanyl-2-methyl-phenyl)ethanamide | MLS002163358 | N-(4-bromo-2-methyl-phenyl)-2-(1,3-diketo-3a,4,7,7a-tetrahydroisoindol-2-yl)acetamide | N-(4-bromo-2-methylphenyl)-2-(1,3-dioxo-3a,4,7,7a-tetrahydroisoindol-2-yl)acetamide | SMR001245748 | cid_4789729
TypeSmall organic molecule
Emp. Form.C17H17BrN2O3
Mol. Mass.377.232
SMILESCc1cc(Br)ccc1NC(=O)CN1C(=O)C2CC=CCC2C1=O |c:18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a