BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50513
Substrate/Competitorn/a
IC50 3130±n/a nM
Citation PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50513
NameBDBM50513
Synonyms:4-(2,6-bis(3,4-dimethylphenyl)-1,3,5,7-tetraoxo-1,2,3,5,6,7-hexahydropyrrolo[3,4-f]isoindole-4-carbonyl)benzoic acid | 4-[2,6-bis(3,4-dimethylphenyl)-1,3,5,7-tetraketo-pyrrol[3,4-f]isoindole-8-carbonyl]benzoic acid | 4-[2,6-bis(3,4-dimethylphenyl)-1,3,5,7-tetrakis(oxidanylidene)pyrrolo[3,4-f]isoindol-8-yl]carbonylbenzoic acid | 4-[2,6-bis(3,4-dimethylphenyl)-1,3,5,7-tetraoxopyrrolo[3,4-f]isoindole-8-carbonyl]benzoic acid | 4-[[2,6-bis(3,4-dimethylphenyl)-1,3,5,7-tetraoxo-8-pyrrolo[3,4-f]isoindolyl]-oxomethyl]benzoic acid | CHEMBL1324382 | MLS000714384 | SMR000274364 | cid_3108985
TypeSmall organic molecule
Emp. Form.C34H24N2O7
Mol. Mass.572.5636
SMILESCc1ccc(cc1C)-n1c(=O)c2cc3c(c(C(=O)c4ccc(cc4)C(O)=O)c2c1=O)c(=O)n(-c1ccc(C)c(C)c1)c3=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a