BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein subunit alpha-16
LigandBDBM29135
Substrate/Competitorn/a
EC50>29902±n/a nM
Citation PubChem, PC Counterscreen for agonists of the human trace amine associated receptor 1 (TAAR1): Fluorescence-based cell-based high throughput dose response assay to identify nonselective Ga16 agonists PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
G-protein subunit alpha-16
Name:G-protein subunit alpha-16
Synonyms:G-protein subunit alpha-16 (G alpha-16) | guanine nucleotide-binding protein subunit alpha-15
Type:Protein
Mol. Mass.:43577.62
Organism:Homo sapiens (Human)
Description:P30679
Residue:374
Sequence:
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29135
NameBDBM29135
Synonyms:CHEMBL11608 | cid_5610 | p-Tyramine | tyramine
TypeSmall organic molecule
Emp. Form.C8H11NO
Mol. Mass.137.179
SMILESNCCc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a