BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettrace amine-associated receptor 1
LigandBDBM29135
Substrate/Competitorn/a
EC50 177.71±n/a nM
Citation PubChem, PC Fluorescence-based cell-based high throughput dose response assay to identify agonists of the human trace amine associated receptor 1 (TAAR1) PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
trace amine-associated receptor 1
Name:Trace amine-associated receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39107.47
Organism:Homo sapiens (Human)
Description:ChEMBL_792734
Residue:339
Sequence:
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29135
NameBDBM29135
Synonyms:CHEMBL11608 | cid_5610 | p-Tyramine | tyramine
TypeSmall organic molecule
Emp. Form.C8H11NO
Mol. Mass.137.179
SMILESNCCc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a