Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-ACP Reductase (FabI)
LigandBDBM97445
Substrate/Competitorn/a
Meas. Tech.Thermal Shift Assay
pH7.5±0
Ki 0.01±0 nM
Citation Chang, ASchiebel, JYu, WBommineni, GRPan, PBaxter, MVKhanna, ASotriffer, CAKisker, CTonge, PJ Rational Optimization of Drug-Target Residence Time: Insights from Inhibitor Binding to the Staphylococcus aureus FabI Enzyme-Product Complex. Biochemistry52:4217-28 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Enoyl-ACP Reductase (FabI)
Name:Enoyl-ACP Reductase (FabI)
Synonyms:Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | NADPH-dependent enoyl-ACP reductase | trans-2-enoyl-[acyl carrier protein] reductase
Type:Enzyme
Mol. Mass.:27989.00
Organism:Staphylococcus aureus
Description:n/a
Residue:256
Sequence:
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM97445
NameBDBM97445
Synonyms:PT119
TypeSmall molecule
Emp. Form.C19H21NO2
Mol. Mass.295.3755
SMILESCCCCCCc1ccc(Oc2ccccc2C#N)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a