BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 9 (TLR9)
LigandBDBM83276
Substrate/Competitorn/a
IC50 160±n/a nM
Citation PubChem, PC Late stage assay provider counterscreen for TLR9 inhibitors: Luminescence-based assay to identify inhibitors of TLR9-dependent cell activation using RAW264.7 cells PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
Toll-like receptor 9 (TLR9)
Name:Toll-like receptor 9 (TLR9)
Synonyms:Toll-like receptor 9
Type:Enzyme
Mol. Mass.:115889.91
Organism:Homo sapiens (Human)
Description:Q9NR96
Residue:1032
Sequence:
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM83276
NameBDBM83276
Synonyms:MLS002702141 | SMR001565706 | [(1E,3E)-4-(benzenesulfonyl)buta-1,3-dienyl]sulfonylbenzene | [(1E,3E)-4-(phenylsulfonyl)buta-1,3-dienyl]sulfonylbenzene | [(1E,3E)-4-besylbuta-1,3-dienyl]sulfonylbenzene | cid_5468033
TypeSmall organic molecule
Emp. Form.C16H14O4S2
Mol. Mass.334.41
SMILESO=S(=O)(\C=C\C=C\S(=O)(=O)c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a