Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon
LigandBDBM100805
Substrate/Competitorn/a
Meas. Tech.Glucagon SPA Assay
pH7.4±0
Ki 38.2±0.0 nM
Citation Aspnes, GEDidiuk, MTFilipski, KJGuzman-Perez, ALee, ECPfefferkorn, JAStevens, BDTu, MM Glucagon receptor modulators US Patent US8507533 Publication Date 8/13/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glucagon
Name:Glucagon
Synonyms:Glucagon receptor (GCGR)
Type:Enzyme
Mol. Mass.:20907.95
Organism:Homo sapiens (Human)
Description:P01275
Residue:180
Sequence:
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM100805
NameBDBM100805
Synonyms:US8507533, 113
TypeSmall organic molecule
Emp. Form.C22H23F3N6O3
Mol. Mass.476.4516
SMILESCCCC(Nc1cnc(nc1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a