Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetALK4
LigandBDBM50262685
Substrate/Competitorn/a
IC50 3080±0.0 nM
Citation Mohedas, AHXing, XArmstrong, KABullock, ANCuny, GDYu, PB Development of an ALK2-Biased BMP Type I Receptor Kinase Inhibitor. ACS Chem Biol8:1291-302 (2013) [PubMed]  Article
More Info.:Get all data from this article
 
ALK4
Name:ALK4
Synonyms:6820432J04 | ActR-IB | ActRIB | Acvrlk4 | SKR2
Type:n/a
Mol. Mass.:56705.93
Organism:Mus musculus
Description:n/a
Residue:505
Sequence:
MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLD
GVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEDYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50262685
NameBDBM50262685
Synonyms:6-(4-(2-(piperidin-1-yl)ethoxy)phenyl)-3-(pyridin-4-yl)pyrazolo[1,5-a]pyrimidine | 6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine | CHEMBL478629 | Dorsomorphin | US9040694, Dorsomorphin
TypeSmall organic molecule
Emp. Form.C24H25N5O
Mol. Mass.399.4882
SMILESC(CN1CCCCC1)Oc1ccc(cc1)-c1cnc2c(cnn2c1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a