Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
LigandBDBM103342
Substrate/Competitorn/a
Meas. Tech.Radioactivity Assay
IC50 10±0.0 nM
Citation Hartmann, RFrotscher, MOberwinkler, SZiegler, EMessinger, JThole, H 17Beta-hydroxysteroid dehydrogenase type 1 inhibitors for the treatment of hormone-related diseases US Patent US8546392 Publication Date 10/1/2013
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
Name:Estradiol 17-beta-dehydrogenase 1
Synonyms:17-beta-HSD 1 | 17-beta-hydroxysteroid dehydrogenase type 1 | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | E2DH | Estradiol 17-beta-dehydrogenase 1 | Placental 17-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:34945.13
Organism:Homo sapiens (Human)
Description:P14061
Residue:328
Sequence:
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103342
NameBDBM103342
Synonyms:US8546392, 64
TypeSmall organic molecule
Emp. Form.C20H19NO3
Mol. Mass.321.3698
SMILESCOc1ccc2cc(ccc2c1)-c1ccc(NC(C)=O)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a