Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50193145
Substrate/Competitorn/a
Meas. Tech.In vitro Hydroxylation Assays for PHD2 (AlphaScreen)
pH7.5±0
IC50>2.0e+4± 0 nM
Citation Chowdhury, RCandela-Lena, JIChan, MCGreenald, DJYeoh, KKTian, YMMcDonough, MATumber, ARose, NRConejo-Garcia, ADemetriades, MMathavan, SKawamura, ALee, MKvan Eeden, FPugh, CWRatcliffe, PJSchofield, CJ Selective Small Molecule Probes for the Hypoxia Inducible Factor (HIF) Prolyl Hydroxylases. ACS Chem Biol8:1488-96 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
D(2) dopamine receptor
Name:D(2) dopamine receptor/Metabotropic glutamate receptor 5
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193145
NameBDBM50193145
Synonyms:2-(1-chloro-4-hydroxyisoquinoline-3-carboxamido)acetic acid | CHEMBL426560 | Isoquinoline 3 | N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE
TypeSmall organic molecule
Emp. Form.C12H9ClN2O4
Mol. Mass.280.664
SMILESOC(=O)CNC(=O)c1nc(Cl)c2ccccc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a