Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast activation protein alpha
LigandBDBM103918
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
IC50 21±0.0 nM
Citation Babich, JWZimmerman, CJoyal, JMaresca, KPMarquis, JLu, GWang, JHillier, S Technetium- and rhenium-bis(heteroaryl) complexes and methods of use thereof US Patent US8562945 Publication Date 10/22/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Fibroblast activation protein alpha
Name:Fibroblast activation protein alpha
Synonyms:170 kDa melanoma membrane-bound gelatinase | Integral membrane serine protease | Seprase
Type:Enzyme
Mol. Mass.:87712.48
Organism:Homo sapiens (Human)
Description:Q12884
Residue:760
Sequence:
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103918
NameBDBM103918
Synonyms:US8562945, 254
TypeSmall organic molecule
Emp. Form.C24H34BN5O4Re
Mol. Mass.653.575
SMILESOB(O)C1CCCN1C(=O)CNC(=O)CCCCC[N]12CC3=CC=CC=[N]3[Re+]1[N]1=C(C2)C=CC=C1 |c:24,26,31,35,37,t:22|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a