Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMicrotubule-associated protein tau
LigandBDBM281643
Substrate/Competitorn/a
Meas. Tech.Tau binding assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 0.784±n/a nM
Commentsextracted
Citation Walji, AMHostetler, EGreshock, TJLi, JMoore, KPBennacef, IMulhearn, JSelnick, HWang, YYang, KFu, J Pyrrolo[2,3-C]pyridines as imaging agents for neurofibrilary tangles US Patent US10022461 Publication Date 7/17/2018
More Info.:Get all data from this article,  Assay Method
 
Microtubule-associated protein tau
Name:Microtubule-associated protein tau
Synonyms:MAPT | MAPTL | MTBT1 | Microtubule-associated protein tau | Neurofibrillary tangle protein | PHF-tau | Paired helical filament-tau | Tau Protein
Type:Protein
Mol. Mass.:78928.63
Organism:Homo sapiens (Human)
Description:P10636
Residue:758
Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM281643
NameBDBM281643
Synonyms:US10022461, Compound 113
TypeSmall organic molecule
Emp. Form.C16H11FN4
Mol. Mass.278.2837
SMILESNc1cc(F)c2cnc(cc2c1)-n1ccc2ccncc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a