Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin-1 Receptor
LigandBDBM107201
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 11.8± 0 nM
Citation Aebi, JBinggeli, AHertel, CKonkar, AAKuehne, HKuhn, BMaerki, HPWang, H Aryl-benzocycloalkyl amide derivatives US Patent US8592426 Publication Date 11/26/2013
More Info.:Get all data from this article,  Assay Method
 
Bradykinin-1 Receptor
Name:Bradykinin-1 Receptor
Synonyms:n/a
Type:Enzyme
Mol. Mass.:71962.11
Organism:Homo sapiens (Human)
Description:P01042
Residue:644
Sequence:
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM107201
NameBDBM107201
Synonyms:US8592426, 51
Typen/a
Emp. Form.C26H21ClFN5O5
Mol. Mass.537.927
SMILESCc1nc(no1)-c1c(F)cc(Cl)cc1-c1ccc2[C@H](CCc2c1)NC(=O)C1(COC1)NC(=O)c1ccno1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a