Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine aminotransferase II (KAT II)
LigandBDBM107744
Substrate/Competitorn/a
Meas. Tech.Inhibition Spectra Assay
IC50 38.8±0.0 nM
Citation Dounay, ABMcAllister, LParikh, VDRong, SVerhoest, PR KAT II inhibitors US Patent US8598200 Publication Date 12/3/2013
More Info.:Get all data from this article,  Assay Method
 
Kynurenine aminotransferase II (KAT II)
Name:Kynurenine aminotransferase II (KAT II)
Synonyms:2-aminoadipate aminotransferase | 2-aminoadipate transaminase | AADAT | Alpha-aminoadipate aminotransferase | KAT/AadAT | KAT2 | Kynurenine aminotransferase II | Kynurenine--oxoglutarate aminotransferase II | Kynurenine--oxoglutarate transaminase 2 | Kynurenine--oxoglutarate transaminase II | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Type:Enzyme
Mol. Mass.:47353.09
Organism:Homo sapiens (Human)
Description:Q8N5Z0
Residue:425
Sequence:
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM107744
NameBDBM107744
Synonyms:US8933095, 28
TypeSmall organic molecule
Emp. Form.C13H11F3N4O2
Mol. Mass.312.2472
SMILESN[C@H]1Cc2cn(nc2N(O)C1=O)-c1ccccc1C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a