Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 4 (CDK4)
LigandBDBM107756
Substrate/Competitorn/a
Meas. Tech.Enzymatic Activity Assay
pH7.5±0
IC50 14± 0 nM
Citation Howard, SMortenson, PNHiscock, SDWoolford, AJWoodhead, AJChessari, GO'Reilly, MCongreve, MSDagostin, CCho, YSYang, FChen, CHBrain, CTLagu, BWang, YKim, SGiraldes, JLuzzio, MJPerez, LB Imidazole derivatives and their use as modulators of cyclin dependent kinases US Patent US8598217 Publication Date 12/3/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-dependent kinase 4 (CDK4)
Name:Cyclin-dependent kinase 4 (CDK4)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21063.86
Organism:Oryctolagus cuniculus (Rabbit)
Description:Q0GMK6
Residue:189
Sequence:
HFVALKSVRVPNGGGAGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKV
TLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMCQFLRGLDFLHANCIVHRDLKPENILVT
SSGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSAGCIFAEMFR
RKPLFCGNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM107756
NameBDBM107756
Synonyms:US8598217, 163
TypeSmall organic molecule
Emp. Form.C26H23N7O
Mol. Mass.449.5071
SMILESO=C(c1nc2nc(ccc2[nH]1)N1CCCNCC1)c1ccnc(c1)-c1cncc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a