Reaction Details |
 | Report a problem with these data |
Target | Cyclin-dependent kinase 4 (CDK4) |
---|
Ligand | BDBM107756 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzymatic Activity Assay |
---|
pH | 7.5±0 |
---|
IC50 | 14± 0 nM |
---|
Citation | Howard, S; Mortenson, PN; Hiscock, SD; Woolford, AJ; Woodhead, AJ; Chessari, G; O'Reilly, M; Congreve, MS; Dagostin, C; Cho, YS; Yang, F; Chen, CH; Brain, CT; Lagu, B; Wang, Y; Kim, S; Giraldes, J; Luzzio, MJ; Perez, LB Imidazole derivatives and their use as modulators of cyclin dependent kinases US Patent US8598217 Publication Date 12/3/2013 |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 4 (CDK4) |
---|
Name: | Cyclin-dependent kinase 4 (CDK4) |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 21063.86 |
Organism: | Oryctolagus cuniculus (Rabbit) |
Description: | Q0GMK6 |
Residue: | 189 |
Sequence: | HFVALKSVRVPNGGGAGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKV
TLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMCQFLRGLDFLHANCIVHRDLKPENILVT
SSGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSAGCIFAEMFR
RKPLFCGNS
|
|
|
BDBM107756 |
---|
Name | BDBM107756 |
Synonyms: | US8598217, 163 |
Type | Small organic molecule |
Emp. Form. | C26H23N7O |
Mol. Mass. | 449.5071 |
SMILES | O=C(c1nc2nc(ccc2[nH]1)N1CCCNCC1)c1ccnc(c1)-c1cncc2ccccc12 |
Structure |
|
n/a |
---|