Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM108316
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 0.1±0.0 nM
Citation Gao, ZHall, DHartung, R Substituted piperidine spiro pyrrolidinone and piperidinone, preparation and therapeutic use thereof US Patent US8604046 Publication Date 12/10/2013
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:n/a
Type:Enzyme
Mol. Mass.:43426.88
Organism:Macaca mulatta (Rhesus macaque)
Description:G7N499
Residue:390
Sequence:
MLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDY
LLCTSSAFNIVLISYDRFLSVTRAVSYRAQQGNTRRAVRKMLLVWVLAFLLYGPAILSWE
YLSGGSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDG
AREAGGPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAAGAEAGETALGGGG
GGGTAASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRK
VAKSLAVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLC
HHSFRRAFTKLLCPQKLKIQPHSSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108316
NameBDBM108316
Synonyms:US8604046, 96
TypeSmall organic molecule
Emp. Form.C30H45FN4O
Mol. Mass.496.7029
SMILESC[C@H]1CCCN1C1CCN(CC1)c1ccc(N2CCC3(CCN(CC4CCCC4)CC3)C2=O)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a