Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-phosphoinositide-dependent protein kinase 1 (51-359)
LigandBDBM281916
Substrate/Competitorn/a
Meas. Tech.PDK1 kinase assay
IC50<100±n/a nM
Citation Arndt, JChan, TGuckian, KKumaravel, GLee, WLin, EYScott, DSun, LThomas, Jvan Vloten, KWang, DZhang, LErlanson, D Heterocyclic compounds useful as PDK1 inhibitors US Patent US10030016 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
3-phosphoinositide-dependent protein kinase 1 (51-359)
Name:3-phosphoinositide-dependent protein kinase 1 (51-359)
Synonyms:3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) | 3-phosphoinositide-dependent protein kinase 1 | PDK1 (51-359) | hPDK1
Type:Enzyme Catalytic Domain
Mol. Mass.:35302.26
Organism:Homo sapiens (Human)
Description:n/a
Residue:309
Sequence:
MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAI
KILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKY
IRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL
SPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLI
FQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL
HQQTPPKLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM281916
NameBDBM281916
Synonyms:US10030016, Example 4.1.17 | US10030016, Example 4.1.18 | US10030016, Example 4.10 | US10030016, Example 4.11 | US10030016, Example 4.12 | US10030016, Example 4.13 | US10030016, Example 4.14 | US10030016, Example 4.15 | US10030016, Example 4.16 | US10030016, Example 4.17 | US10030016, Example 4.18 | US10030016, Example 4.19 | US10030016, Example 4.4 | US10030016, Example 4.5 | US10030016, Example 4.6 | US10030016, Example 4.7 | US10030016, Example 4.8 | US10030016, Example 4.9
TypeSmall organic molecule
Emp. Form.C35H35N5O6S
Mol. Mass.653.747
SMILESCCOC(=O)c1cccnc1NCc1cc(OC(C)C)cc(c1)-c1cn(c2ncc(cc12)C(=O)NC1CC1)S(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a