Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-phosphoinositide-dependent protein kinase 1 (51-359)
LigandBDBM282375
Substrate/Competitorn/a
Meas. Tech.PDK1 kinase assay
IC50<100±n/a nM
Citation Arndt, JChan, TGuckian, KKumaravel, GLee, WLin, EYScott, DSun, LThomas, Jvan Vloten, KWang, DZhang, LErlanson, D Heterocyclic compounds useful as PDK1 inhibitors US Patent US10030016 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
3-phosphoinositide-dependent protein kinase 1 (51-359)
Name:3-phosphoinositide-dependent protein kinase 1 (51-359)
Synonyms:3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) | 3-phosphoinositide-dependent protein kinase 1 | PDK1 (51-359) | hPDK1
Type:Enzyme Catalytic Domain
Mol. Mass.:35302.26
Organism:Homo sapiens (Human)
Description:n/a
Residue:309
Sequence:
MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAI
KILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKY
IRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL
SPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLI
FQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL
HQQTPPKLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM282375
NameBDBM282375
Synonyms:(S)-5-cyano-N-(1-(4- fluorophenyl)ethyl)-2- (3-(2-(methylamino) quinazolin-6-yl)prop-2- ynylamino)nicotinamide | US10030016, Example 255
TypeSmall organic molecule
Emp. Form.C27H22FN7O
Mol. Mass.479.5083
SMILESCNc1ncc2cc(ccc2n1)C#CCNc1ncc(cc1C(=O)N[C@@H](C)c1ccc(F)cc1)C#N |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a