Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPvdQ
LigandBDBM113772
Substrate/Competitorn/a
Meas. Tech.PvdQ IC50 Assay
IC50 2e+1± 1e+1 nM
Citation Wurst, JMDrake, EJTheriault, JRJewett, ITVerPlank, LPerez, JRDandapani, SPalmer, MMoskowitz, SMSchreiber, SLMunoz, BGulick, AM Identification of Inhibitors of PvdQ, an Enzyme Involved in the Synthesis of the Siderophore Pyoverdine. ACS Chem Biol9:1536-44 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PvdQ
Name:PvdQ
Synonyms:n/a
Type:Protein
Mol. Mass.:84038.62
Organism:Pseudomonas aeruginosa
Description:Ntn hydrolase
Residue:762
Sequence:
MGMRTVLTGLAGMLLGSMMPVQADMPRPTGLAADIRWTAYGVPHIRAKDERGLGYGIGYA
YARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQT
PAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFAD
ALVAAAPPGTEKVALSGEQAFQVAEQRRQRFRLERGSNAIAVGSERSADGKGMLLANPHF
PWNGAMRFYQMHLTIPGRLDVMGASLPGLPVVNIGFSRHLAWTHTVDTSSHFTLYRLALD
PKDPRRYLVDGRSLPLEEKSVAIEVRGADGKLSRVEHKVYQSIYGPLVVWPGKLDWNRSE
AYALRDANLENTRVLQQWYSINQASDVADLRRRVEALQGIPWVNTLAADEQGNALYMNQS
VVPYLKPELIPACAIPQLVAEGLPALQGQDSRCAWSRDPAAAQAGITPAAQLPVLLRRDF
VQNSNDSAWLTNPASPLQGFSPLVSQEKPIGPRARYALSRLQGKQPLEAKTLEEMVTANH
VFSADQVLPDLLRLCRDNQGEKSLARACAALAQWDRGANLDSGSGFVYFQRFMQRFAELD
GAWKEPFDAQRPLDTPQGIALDRPQVATQVRQALADAAAEVEKSGIPDGARWGDLQVSTR
GQERIAIPGGDGHLGVYNAIQSVRKGDHLEVVGGTSYIQLVTFPEEGPKARGLLAFSQSS
DPRSPHYRDQTELFSRQQWQTLPFSDRQIDADPQLQRLSIRE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113772
NameBDBM113772
Synonyms:2-(4-Fluorophenyl)-2-(6-(trifluoromethyl)pyridin-2-yl) acetonitrile (4)
TypeSmall organic molecule
Emp. Form.C14H8F4N2
Mol. Mass.280.2203
SMILESFc1ccc(cc1)C(C#N)c1cccc(n1)C(F)(F)F
Structure
n/a