BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetprotein artemis isoform a
LigandBDBM51800
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of small molecule inhibitors originally identified via uHTS of Artemis endonuclease activity via a fluorescence intensity assay
IC50 20000±n/a nM
Citation PubChem, PC Dose Response confirmation of small molecule inhibitors originally identified via uHTS of Artemis endonuclease activity via a fluorescence intensity assay PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
protein artemis isoform a
Name:protein artemis isoform a
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:78427.91
Organism:Homo sapiens
Description:gi_76496497
Residue:692
Sequence:
MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLY
CSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSV
MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE
ECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPE
ILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK
TNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCR
SSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA
VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQ
KADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQS
THITEQGSQGWDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKD
TYSDLKSRDKDVTIVPSTGEPTTLSSETHIPEEKSLLNLSTNADSQSSSDFEVPSTPEAE
LPKREHLQYLYEKLATGESIAVKKRKCSLLDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51800
NameBDBM51800
Synonyms:4-(1H-indol-3-yl)-N-methyl-1,3-thiazol-2-amine | 4-(1H-indol-3-yl)-N-methyl-2-thiazolamine | MLS000554792 | SMR000146909 | [4-(1H-Indol-3-yl)-thiazol-2-yl]-methyl-amine | [4-(1H-indol-3-yl)thiazol-2-yl]-methyl-amine | cid_912884
TypeSmall organic molecule
Emp. Form.C12H11N3S
Mol. Mass.229.301
SMILESCNc1nc(cs1)-c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a