Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 7B
LigandBDBM116310
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay
pH8±n/a
IC50 9.27±n/a nM
Commentsextracted
Citation Bergmann, JECutshall, NSDemopulos, GAFlorio, VAGaitanaris, GGray, PHohmann, JOnrust, RZeng, H Use of PDE7 inhibitors for the treatment of movement disorders US Patent US8637528 Publication Date 1/28/2014
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Synonyms:Phosphodiesterase 7B | Phosphodiesterase 7B (PDE7B)
Type:Enzyme
Mol. Mass.:51842.76
Organism:Homo sapiens (Human)
Description:Q9NP56
Residue:450
Sequence:
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM116310
NameBDBM116310
Synonyms:US8637528, OM056
TypeSmall organic molecule
Emp. Form.C19H23N5O2
Mol. Mass.353.4182
SMILESCOc1cc(N)ccc1-c1nc2c(C)nn(C3CCCCC3)c2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a