Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-lysine methyltransferase SMYD2
LigandBDBM50181508
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay (SPA) for Detection of SMYD2 Enzymatic Inhibition
pH9±n/a
IC50 1320±n/a nM
Commentsextracted
Citation Mowat, JSStellfeld, TStresemann, CHillig, RKöhr, SStöckigt, DWeiske, JBrumby, TBarak, NChrist, CTer Laak, ABadock, VCrampton, RHStefanuti, I Aryl-cyanoguanidine compounds US Patent US10023539 Publication Date 7/17/2018
More Info.:Get all data from this article,  Assay Method
 
N-lysine methyltransferase SMYD2
Name:N-lysine methyltransferase SMYD2
Synonyms:HSKM-B | Histone methyltransferase SMYD2 | KMT3C | Lysine N-methyltransferase 3C | N-lysine methyltransferase SMYD2 | SET and MYND domain-containing protein 2 | SMYD2
Type:Enzyme
Mol. Mass.:49689.57
Organism:Homo sapiens (Human)
Description:Q9NRG4
Residue:433
Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181508
NameBDBM50181508
Synonyms:CHEMBL3818083 | US10023539, Example 4.2
TypeSmall organic molecule
Emp. Form.C22H20Cl2F2N6O3
Mol. Mass.525.335
SMILESCCN(C1CN(N=C1c1ccc(Cl)c(Cl)c1)C(\Nc1cccc(OC(F)F)c1)=N/C#N)C(=O)CO |c:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a