Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPrephenate dehydrogenase TyrA (PDH)
LigandBDBM119877
Substrate/Competitorn/a
Meas. Tech.Enzyme Assays
Ki 155±12 nM
Citation Bryk, RArango, NMaksymiuk, CBalakrishnan, AWu, YTWong, CHMasquelin, THipskind, PLima, CDNathan, C Lipoamide channel-binding sulfonamides selectively inhibit mycobacterial lipoamide dehydrogenase. Biochemistry52:9375-84 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prephenate dehydrogenase TyrA (PDH)
Name:Prephenate dehydrogenase TyrA (PDH)
Synonyms:n/a
Type:Protein
Mol. Mass.:33096.86
Organism:Mycobacterium tuberculosis H37Rv
Description:O69721
Residue:323
Sequence:
MTRTVAAPPVCVLGLGLIGGSIMRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQT
LTRAAATEALIVLAVPMPALPGMLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYV
GGHPMTGTAHSGWTAGHGGLFNRAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDE
HDAAAAAVSHLPHLLAEALAVTAAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTG
QLAPAADRIIDLLSRARDSLQSHGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWRE
QLAAAGRAGGVITSALPSLDSPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM119877
NameBDBM119877
Synonyms:SL809 | US9073941, 502
TypeSmall organic molecule
Emp. Form.C16H19BrN4O5S
Mol. Mass.459.315
SMILESCOc1ccc(NC(=O)CN(C)S(=O)(=O)c2cc(Br)cnc2N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a