Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHypoxia-inducible factor (HIF-PH2)
LigandBDBM123023
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 150±n/a nM
Citation Kang, XLong, WMa, CWang, YCao, HWang, YTan, FHu, Y Compounds as hypoxia mimetics, and compositions and uses thereof US Patent US8742138 Publication Date 6/3/2014
More Info.:Get all data from this article,  Assay Method
 
Hypoxia-inducible factor (HIF-PH2)
Name:Hypoxia-inducible factor (HIF-PH2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36098.74
Organism:Rattus norvegicus (Rat)
Description:P59722
Residue:338
Sequence:
PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPS
SEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKH
GICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPG
CETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVT
CIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYA
ITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123023
NameBDBM123023
Synonyms:US8742138, 8
TypeSmall organic molecule
Emp. Form.C19H12F3NO7
Mol. Mass.423.2963
SMILESOC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a