Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1 (S1P1)
LigandBDBM123467
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 1.1±n/a nM
Citation Muzerelle, MQuattropani, AMontagne, CDorbais, J Oxadiazole fused heterocyclic derivatives useful for the treatment of multiple sclerosis US Patent US8741923 Publication Date 6/3/2014
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1 (S1P1)
Name:Sphingosine 1-phosphate receptor 1 (S1P1)
Synonyms:Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123467
NameBDBM123467
Synonyms:US8741923, 40
TypeSmall organic molecule
Emp. Form.C29H29N3O4
Mol. Mass.483.5583
SMILESCOCc1cc(ccc1-c1ccccc1C)-c1nc(no1)-c1ccc2CN(CCC(O)=O)CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a