Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase D (PLD_sp)
LigandBDBM50345704
Substrate/Competitorn/a
Meas. Tech.PLD In Vitro Kinetic Assay
Temperature310.15±0 K
IC50 375±n/a nM
Citation Kulkarni, AQuang, PCurry, VKeyes, RZhou, WCho, HBaffoe, JTorok, BStieglitz, K 1,3-disubstituted-4-aminopyrazolo [3, 4-d] pyrimidines, a new class of potent inhibitors for phospholipase D. Chem Biol Drug Des84:270-81 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase D (PLD_sp)
Name:Phospholipase D (PLD_sp)
Synonyms:n/a
Type:Protein
Mol. Mass.:54006.04
Organism:Streptomyces sp. PMF
Description:P84147
Residue:506
Sequence:
ADSATPHLDAVEQTLRQVSPGLEGDVWERTSGNKLDGSAADPSDWLLQTPGCWGDDKCAD
RVGTKRLLAKMTENIGNATRTVDISTLAPFPNGAFQDAIVAGLKESAAKGNKLKVRILVG
AAPVYHMNVIPSKYRDELTAKLGKAAENITLNVASMTTSKTAFSWNHSKILVVDGQSALT
GGINSWKDDYLDTTHPVSDVDLALTGPAAGSAGRYLDTLWTWTCQNKSNIASVWFAASGN
AGCMPTMHKDTNPKASPATGNVPVIAVGGLGVGIKDVDPKSTFRPDLPTASDTKCVVGLH
DNTNADRDYDTVNPEESALRALVASAKGHIEISQQDLNATCPPLPRYDIRLYDALAAKMA
AGVKVRIVVSDPANRGAVGSGGYSQIKSLSEISDTLRNRLANITGGQQAAKTAMCSNLQL
ATFRSSPNGKWADGHPYAQHHKLVSVDSSTFYIGSKNLYPSWLQDFGYIVESPEAAKQLD
AKLLDPQWKYSQETATVDYARGICNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345704
NameBDBM50345704
Synonyms:1-(tert-butyl)-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 1-tert-butyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3) | 1-tert-butyl-3-naphthalen-2-yl-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL1231371 | CHEMBL2069957 | US9518026, Example 2 | US9765037, Compound 2
TypeSmall organic molecule
Emp. Form.C19H19N5
Mol. Mass.317.3877
SMILESCC(C)(C)n1nc(-c2ccc3ccccc3c2)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a