Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodopsin kinase
LigandBDBM50173314
Substrate/Competitorn/a
Meas. Tech.Assays for Inhibition of GRKs
pH7±n/a
IC50 71000±n/a nM
Commentsextracted
Citation Larsen, SDHoman, KWaldschmidt, HTesmer, JJ G protein-coupled receptor kinase 2 inhibitors and methods for use of the same US Patent US10023564 Publication Date 7/17/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodopsin kinase
Name:Rhodopsin kinase
Synonyms:G protein-coupled receptor kinase 1 | GRK1 | PK | RHOK
Type:PROTEIN
Mol. Mass.:63520.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774378
Residue:563
Sequence:
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173314
NameBDBM50173314
Synonyms:CHEMBL3808840 | US10023564, Example 16
TypeSmall organic molecule
Emp. Form.C27H23FN6O3
Mol. Mass.498.5083
SMILESCC1=C(C(NC(=O)N1)c1ccc(F)c(c1)C(=O)NCc1ccccc1)C(=O)Nc1ccc2[nH]ncc2c1 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a