Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucyl-cystinyl aminopeptidase
LigandBDBM284942
Substrate/Competitorn/a
Meas. Tech.Inhibition of IRAP Activity
IC50 0.800±n/a nM
Citation Kawaguchi, KIshihata, AKanai, AInagaki, YHiramoto, MEnjo, KTakamatsu, H Bicyclic pyridine compound US Patent US10023583 Publication Date 7/17/2018
More Info.:Get all data from this article,  Assay Method
 
Leucyl-cystinyl aminopeptidase
Name:Cystinyl aminopeptidase
Synonyms:Cystinyl aminopeptidase | GP160 | IRAP | Insulin-regulated membrane aminopeptidase | Insulin-responsive aminopeptidase | Irap | Lnpep | OTase | Otase | Oxytocinase | P-LAP | Placental leucine aminopeptidase | Vesicle protein of 165 kDa | Vp165
Type:PROTEIN
Mol. Mass.:117179.39
Organism:Rattus norvegicus
Description:ChEMBL_98523
Residue:1025
Sequence:
METFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMDEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGTCSVPSARTLVICVFVIVV
AVSVIMVIYLLPRCTFTKEGCHKTNQSAELIQPIATNGKVFPWAQIRLPTAIIPQRYELS
LHPNLTSMTFRGSVTISLQALQDTRDIILHSTGHNISSVTFMSAVSSQEKQVEILEYPYH
EQIAVVAPESLLTGHNYTLKIEYSANISNSYYGFYGITYTDKSNEKKNFAATQFEPLAAR
SAFPCFDEPAFKATFIIKITRDEHHTALSNMPKKSSVPTEEGLIQDEFSESVKMSTYLVA
FIVGEMRNLSQDVNGTLVSVYAVPEKIDQVYHALDTTVKLLEFYQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWW
NDLWLNEGFATFMEYFSVEKIFKELNSYEDFLDARFKTMRKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGASLLLMLKSYLSEDVFQHAIILYLHNHSYAAIQSDDLWDSFNEVTGKT
LDVKKMMKTWTLQKGFPLVTVQRKGTELLLQQERFFPSMQPEIQDSDTSHLWHIPISYVT
DGRNYSEYRSVSLLDKKSDVINLTEQVQWVKVNTNMTGYYIVHYAHDGWAALINQLKRNP
YVLSDKDRANLINNIFELAGLGKVPLQMAFDLIDYLRNETHTAPITEALFQTDLIYNLLE
KLGHMDLSSRLVTRVHKLLQNQIQQQTWTDEGTPSMRELRSALLEFACAHSLENCTTMAT
KLFDGWMASNGTQSLPTDVMTTVFKVGARTEKGWLFLFSMYSSMGSEAEKDKILEALASS
ADAHKLYWLMKSSLDGDIIRTQKLSLIIRTVGRQFPGHLLAWDFVKENWNKLVHKFHLGS
YTIQSIVAGSTHLFSTKTHLSEVQEFFENQSEATLQLRCVQEAFEVIELNIQWMARNLKT
LTLWL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM284942
NameBDBM284942
Synonyms:US10023583, Example 14
TypeSmall organic molecule
Emp. Form.C22H30N2O4
Mol. Mass.386.4846
SMILESN[C@@H](CCC1CCC1)[C@](O)(Cc1nccc2oc(CCC3CC3)cc12)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a