Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT
LigandBDBM126611
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibition Assay
IC50 0.31±n/a nM
Citation Nakamura, MNiiyama, KKamijo, KOhkubo, MShimomura, T Imidazo-oxazine compound or salt thereof US Patent US8772283 Publication Date 7/8/2014
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT
Name:Serine/threonine-protein kinase AKT
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT2
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM126611
NameBDBM126611
Synonyms:US8772283, 55
TypeSmall organic molecule
Emp. Form.C30H30N4O3
Mol. Mass.494.5842
SMILESn/a
Structure 
n/a