Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metallopeptidase 13 (MMP13)
LigandBDBM126726
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 0.2±n/a nM
Citation Abeywardane, AFarmer, BFarrow, NAGao, DAHeim-Riether, ASmith Keenan, LLMugge, IATaylor, SJXiong, ZYu, YZhang, Q Heteroaryl substituted indole compounds useful as MMP-13 inhibitors US Patent US8785489 Publication Date 7/22/2014
More Info.:Get all data from this article,  Assay Method
 
Matrix metallopeptidase 13 (MMP13)
Name:Matrix metallopeptidase 13 (MMP13)
Synonyms:n/a
Type:Protein
Mol. Mass.:54166.75
Organism:Mus musculus (Mouse)
Description:Q3U9V5
Residue:472
Sequence:
MHSAILATFFLLSWTPCWSLPLPYGDDDDDDLSEEDLVFAEHYLKSYYHPATLAGILKKS
TVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLT
YRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFD
GPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGAL
MFPIYTYTGKSHFMLPDDDVQGIQFLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGE
TMIFKDRFFWRLHPQQVEAELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNG
YDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFFSENHVWSYDDVNQTMDKDYPRL
IEEEFPGIGNKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSILWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM126726
NameBDBM126726
Synonyms:US8785489, 5-methyl-4-[2-(3-methyl-1,2,4-oxadiazol-5-yl)-1H-indol-5-yl]-N-[(6-oxo-1,6-dihydropyridin-3-yl)methyl]-1H-imidazole-2-carboxamide
TypeSmall organic molecule
Emp. Form.C22H19N7O3
Mol. Mass.429.4314
SMILESCc1noc(n1)-c1cc2cc(ccc2[nH]1)-c1nc([nH]c1C)C(=O)NCc1ccc(=O)[nH]c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a